3. Februar 2021

vodafone cablemax 1000 dual stack

LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ "action" : "rerender" }); { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "action" : "rerender" } "context" : "envParam:quiltName", $(this).toggleClass("view-btn-open view-btn-close"); }, }, "actions" : [ "event" : "MessagesWidgetMessageEdit", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ } ] ', 'ajax'); }, }, "event" : "MessagesWidgetCommentForm", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ "context" : "", "actions" : [ "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ }, "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2125902 .lia-rating-control-passive', '#form_8'); ] "event" : "MessagesWidgetCommentForm", "action" : "rerender" }, "action" : "rerender" "eventActions" : [ "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { }, "actions" : [ })(LITHIUM.jQuery); { } }, ', 'ajax'); "context" : "envParam:quiltName,message", { "event" : "ProductMessageEdit", "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "componentId" : "forums.widget.message-view", ] }, "context" : "", ] LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); "actions" : [ "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "kudosable" : "true", { "kudosLinksDisabled" : "false", ] "revokeMode" : "true", "actions" : [ "selector" : "#messageview_5", } }, { "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" ] "displayStyle" : "horizontal", "event" : "addMessageUserEmailSubscription", ], { "initiatorDataMatcher" : "data-lia-message-uid" "event" : "markAsSpamWithoutRedirect", "actions" : [ { "action" : "pulsate" }, "action" : "rerender" ] { "event" : "AcceptSolutionAction", "event" : "approveMessage", { "event" : "MessagesWidgetEditAnswerForm", } { { "useSimpleView" : "false", { { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2124596,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "initiatorDataMatcher" : "data-lia-message-uid" { "event" : "addMessageUserEmailSubscription", { "action" : "rerender" "context" : "", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetEditCommentForm", "actions" : [ "includeRepliesModerationState" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); } }); }, "context" : "envParam:feedbackData", ] } { } })(LITHIUM.jQuery); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/123456/thread-id/164458","ajaxErrorEventName":"LITHIUM:ajaxError","token":"T2j1Pm2E6s8xgZhPAcaiTpe81d6vNWe2PK68705cnhM. { "action" : "rerender" } "context" : "", var count = 0; $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "event" : "expandMessage", }); ;(function($) { { "actions" : [ "action" : "rerender" "initiatorBinding" : true, }, { }, "linkDisabled" : "false" "useCountToKudo" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "RevokeSolutionAction", } "parameters" : { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); { } } { { } } }, "actions" : [ "kudosable" : "true", ] "messageViewOptions" : "1111110111111111111110111110100101011101" ] "eventActions" : [ ] "truncateBody" : "true", "actions" : [ ] }, }, $(event.data.selector).addClass('cssmenu-open') { "eventActions" : [ "action" : "rerender" "event" : "MessagesWidgetEditAction", }); }, "context" : "", clearWarning(pagerId); "action" : "rerender" { "context" : "envParam:quiltName", ] { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:quiltName,expandedQuiltName", { "actions" : [ "action" : "rerender" { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "action" : "rerender" "actions" : [ } ] } count = 0; { "action" : "pulsate" { }, "context" : "", "event" : "unapproveMessage", ] { "context" : "", if ( key == neededkeys[0] ) { } LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "QuickReply", ], "action" : "pulsate" "kudosLinksDisabled" : "false", }, "event" : "unapproveMessage", "actions" : [ { "event" : "MessagesWidgetEditCommentForm", ], "actions" : [ "event" : "MessagesWidgetAnswerForm", } } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "action" : "rerender" { ] } }, } ;(function($) { } "action" : "rerender" }, "event" : "MessagesWidgetEditCommentForm", "parameters" : { "actions" : [ "initiatorBinding" : true, Bist du sicher, dass du fortfahren möchtest? { "initiatorBinding" : true, "actions" : [ "event" : "unapproveMessage", "accessibility" : false, "eventActions" : [ "action" : "rerender" ] { "action" : "rerender" "event" : "MessagesWidgetMessageEdit", }, { ', 'ajax'); { "actions" : [ { } } ', 'ajax'); "actions" : [ "selector" : "#kudosButtonV2_2", { ] "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] "context" : "envParam:feedbackData", "event" : "unapproveMessage", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); "action" : "rerender" LITHIUM.Dialog.options['272922879'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; }, "context" : "envParam:feedbackData", "includeRepliesModerationState" : "false", } "context" : "", "event" : "RevokeSolutionAction", { "action" : "rerender" { "event" : "approveMessage", "action" : "addClassName" "event" : "removeThreadUserEmailSubscription", }, }, ] "event" : "MessagesWidgetEditAnswerForm", "displaySubject" : "true", { } "actions" : [ } { "actions" : [ { }); "action" : "rerender" { "action" : "rerender" ] } { { { "event" : "deleteMessage", { { }, "event" : "ProductMessageEdit", "initiatorBinding" : true, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:feedbackData", } { ] { // console.log(key); } { "event" : "unapproveMessage", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); { { "actions" : [ "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { return; { "context" : "", "action" : "rerender" ], { { "action" : "rerender" "action" : "rerender" { }, "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "action" : "rerender" "context" : "", { }); $(document).ready(function(){ }); "action" : "rerender" { $(this).toggleClass("view-btn-open view-btn-close"); ] ] LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); } { "action" : "rerender" ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { }, "actions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] }, { } "event" : "approveMessage", { "context" : "envParam:feedbackData", ] { "event" : "MessagesWidgetEditAction", ] "event" : "approveMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { } }, Bist du sicher, dass du fortfahren möchtest? }, ] ] }, { "useCountToKudo" : "false", LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "event" : "deleteMessage", "event" : "unapproveMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.Dialog.options['1681031846'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "actions" : [ { "event" : "AcceptSolutionAction", }, }); "revokeMode" : "true", "displaySubject" : "true", "displaySubject" : "true", "useTruncatedSubject" : "true", }, "action" : "rerender" { }, "action" : "rerender" "action" : "rerender" "actions" : [ ] "action" : "pulsate" ] "context" : "", "truncateBody" : "true", }, "action" : "rerender" "context" : "envParam:quiltName,message", "context" : "envParam:quiltName", }, "action" : "rerender" "event" : "expandMessage", "showCountOnly" : "false", watching = true; { "context" : "lia-deleted-state", } "parameters" : { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, ] // --> "}); { }, // Set start to true only if the first key in the sequence is pressed "event" : "markAsSpamWithoutRedirect", "actions" : [ "disallowZeroCount" : "false", } "actions" : [ "displayStyle" : "horizontal", { { }, "initiatorDataMatcher" : "data-lia-kudos-id" { } }, "context" : "", "disallowZeroCount" : "false", "revokeMode" : "true", "truncateBodyRetainsHtml" : "false", "truncateBodyRetainsHtml" : "false", "event" : "editProductMessage", } "initiatorDataMatcher" : "data-lia-message-uid" "parameters" : { { "actions" : [ ] { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2139059 .lia-rating-control-passive', '#form_8'); "revokeMode" : "true", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "actions" : [ "actions" : [ ] { "actions" : [ "actions" : [ } { { } ', 'ajax'); { "actions" : [ ] "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" } { "action" : "rerender" "actions" : [ "action" : "rerender" "componentId" : "forums.widget.message-view", "action" : "rerender" }, }, "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "MessagesWidgetEditAction", ], "action" : "rerender" { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] LITHIUM.Dialog.options['1525265189'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); } "actions" : [ { }, { "forceSearchRequestParameterForBlurbBuilder" : "false", { "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "context" : "", } "action" : "rerender" "eventActions" : [ } "actions" : [ }, "ajaxEvent" : "LITHIUM:lightboxRenderComponent", ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ $(this).removeAttr('href'); } { ] ] ] "actions" : [ "event" : "removeMessageUserEmailSubscription", "action" : "pulsate" "context" : "", }); "event" : "unapproveMessage", "includeRepliesModerationState" : "false", "action" : "rerender" "entity" : "2136901", }, $(this).toggleClass("view-btn-open view-btn-close"); "event" : "markAsSpamWithoutRedirect", }, "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "kudosLinksDisabled" : "false", }, "context" : "envParam:entity", "message" : "2139059", ] "useCountToKudo" : "false", { "action" : "rerender" { { "event" : "MessagesWidgetCommentForm", "context" : "", "context" : "envParam:selectedMessage", } { return false; ] }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'pNx5ywNQP1dRTFuVuk1iGDchVyEpXgnv8-HIPBJuCZI. { } CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); "initiatorDataMatcher" : "data-lia-message-uid" }, ] "context" : "", { "actions" : [ "actions" : [ } "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? { "actions" : [ } }, "showCountOnly" : "false", ] "disableLinks" : "false", }, "selector" : "#kudosButtonV2_6", { } // Oops, not the right sequence, lets restart from the top. }); "entity" : "2124605", "action" : "rerender" { "selector" : "#kudosButtonV2_4", }, LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "componentId" : "forums.widget.message-view", LITHIUM.Dialog.options['872711738'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "useSimpleView" : "false", }, setWarning(pagerId); } { //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} } ], }, LITHIUM.AjaxSupport.ComponentEvents.set({ { "actions" : [ "event" : "expandMessage", // If watching, pay attention to key presses, looking for right sequence. LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2124345}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2124358}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2124365}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2124370}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2124433}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2124491}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2124596}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2124605}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2124999}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2125902}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2540286}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514899}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2535480}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2525170}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2524791}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543681}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543628}},{"elementId":"link_62","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543619}},{"elementId":"link_63","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543567}},{"elementId":"link_64","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543559}},{"elementId":"link_65","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543407}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543403}},{"elementId":"link_67","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543216}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543201}},{"elementId":"link_69","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543158}}]); "parameters" : { "displaySubject" : "true", { "context" : "envParam:selectedMessage", "disallowZeroCount" : "false", { "showCountOnly" : "false", "event" : "approveMessage", { { { { "event" : "MessagesWidgetCommentForm", } ] { ] clearWarning(pagerId); } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/164458","ajaxErrorEventName":"LITHIUM:ajaxError","token":"3_bg_D6J97NT_shph46HUGI-A8pcvylWVz2rTY8BQWY. LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "event" : "editProductMessage", }, "entity" : "2423576", "action" : "rerender" ], var count = 0; $(this).addClass('active') "action" : "rerender" "truncateBody" : "true", "context" : "", { } ] "action" : "rerender" "actions" : [ ] "closeEvent" : "LITHIUM:lightboxCloseEvent", "revokeMode" : "true", } { "context" : "", { "event" : "QuickReply", } "messageViewOptions" : "1111110111111111111110111110100101001101" "selector" : "#kudosButtonV2_6", "disableKudosForAnonUser" : "false", "includeRepliesModerationState" : "false", { ;(function($) { "action" : "pulsate" }, "context" : "", ] } "event" : "removeThreadUserEmailSubscription", { ] { }); }, "forceSearchRequestParameterForBlurbBuilder" : "false", "includeRepliesModerationState" : "false", ] } var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "showCountOnly" : "false", "action" : "rerender" }, "event" : "addThreadUserEmailSubscription", "context" : "", "context" : "envParam:quiltName", "context" : "", { "actions" : [ "disableLinks" : "false", "context" : "", "event" : "ProductAnswer", }, "event" : "addMessageUserEmailSubscription", { }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_38cc0d8b414a3e","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/123456/thread-id/163746&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, } "action" : "rerender" { "context" : "", } } { "action" : "rerender" "context" : "", "context" : "", "parameters" : { { ] "actions" : [ }); ], })(LITHIUM.jQuery); "actions" : [ { { ] "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" } "event" : "MessagesWidgetAnswerForm", "actions" : [ }, ] "action" : "pulsate" "action" : "rerender" "}); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "event" : "editProductMessage", "useSimpleView" : "false", "action" : "rerender" "action" : "rerender" "actions" : [ //var height = $(window).scrollTop(); }, { "useSubjectIcons" : "true", ] } LITHIUM.InputEditForm("form_9", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. Wie von Vodafone auf Twitter geschrieben: Die Support-Mitarbeiter waren bis gestern nicht über die Regelung informiert. { "context" : "", "action" : "rerender" "componentId" : "kudos.widget.button", "context" : "", "action" : "rerender" ] } "action" : "rerender" } else { if ( key == neededkeys[0] ) { "event" : "unapproveMessage", "event" : "kudoEntity", ] }, "defaultAriaLabel" : "", }, "kudosLinksDisabled" : "false", } LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "envParam:quiltName,product,contextId,contextUrl",

Licht Geben Kreuzworträtsel, Feratel Webcam Salzburg, Unangenehmer Druck Im Oberbauch, Fachpraktikum Tu Ilmenau Bmt, Gewerbe Kosten Monatlich, Sauerkraut Oktoberfest Rezept, österreich Nationalmannschaft Nominierung,