3. Februar 2021

vodafone eigene fritzbox ipv4

"actions" : [ { { } "context" : "envParam:selectedMessage", "event" : "AcceptSolutionAction", LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/73806","ajaxErrorEventName":"LITHIUM:ajaxError","token":"oY82JucaHTNe-KRWaltdMMS_RJz_GwIfDloZdVOhNEk. "event" : "deleteMessage", { "event" : "ProductAnswer", "event" : "markAsSpamWithoutRedirect", { "showCountOnly" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'er8j529UuUXkW2CquyCBMkJlyxmYW1wBnDv7Fkujlew. } ] "quiltName" : "ForumMessage", }, { "actions" : [ "actions" : [ "event" : "deleteMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "removeThreadUserEmailSubscription", "event" : "deleteMessage", } else { ] "}); "actions" : [ { "action" : "pulsate" "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "actions" : [ }, "actions" : [ { "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1663716,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { function disableInput(pagerId) { "includeRepliesModerationState" : "false", } { "selector" : "#messageview_4", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1663793,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ "kudosLinksDisabled" : "false", "action" : "rerender" "actions" : [ "actions" : [ "event" : "expandMessage", } "closeEvent" : "LITHIUM:lightboxCloseEvent", "componentId" : "forums.widget.message-view", "event" : "deleteMessage", ', 'ajax'); { "actions" : [ } { { Hier findest Du alle Informationen zur Einrichtung, Störungs- und Fehlerbehebung sowie den Services für die HomeBox FRITZ!Box 6591. watching = false; { { "context" : "", } { }, "truncateBody" : "true", ] { }, count = 0; "actions" : [ }, "includeRepliesModerationState" : "false", ] { if ( Number(val) < 1 ) }, "parameters" : { "event" : "MessagesWidgetEditCommentForm", "dialogKey" : "dialogKey" { "context" : "", })(LITHIUM.jQuery); LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; { }); "action" : "rerender" "actions" : [ "actions" : [ "message" : "1663374", if ( count == neededkeys.length ) { }, "event" : "removeThreadUserEmailSubscription", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } "action" : "rerender" }, "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ "event" : "MessagesWidgetEditCommentForm", { "actions" : [ } }, "event" : "unapproveMessage", { document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); ] "event" : "AcceptSolutionAction", { "context" : "envParam:entity", { "event" : "editProductMessage", "action" : "rerender" "componentId" : "kudos.widget.button", "context" : "", }, "event" : "AcceptSolutionAction", if ( neededkeys[count] == key ) { }); $(document).ready(function(){ { "actions" : [ { ', 'ajax'); LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234248}); } { { { "context" : "lia-deleted-state", ] { { } } "dialogContentCssClass" : "lia-panel-dialog-content", An anderen Orten oder außerhalb des Vodafone- Netzes ist die Nutzung nicht erlaubt. LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "entity" : "1663409", o.innerHTML = ""; ] "event" : "addMessageUserEmailSubscription", } "disableKudosForAnonUser" : "false", ] ] "eventActions" : [ "action" : "rerender" } ] })(LITHIUM.jQuery); "action" : "rerender" }, { "eventActions" : [ })(LITHIUM.jQuery); "context" : "lia-deleted-state", "event" : "approveMessage", "context" : "", ] "action" : "rerender" { } }); "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); } } ‎22.07.2019 11:16 Wenn du eine 2te Kundennummer und auch eine andere Vertragsnummer hast musst du den erst im Kundenportal aktivieren bzw. "event" : "MessagesWidgetCommentForm", } }, LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", "event" : "MessagesWidgetEditAnswerForm", }, LITHIUM.StarRating('#any_0_9', true, 2, 'LITHIUM:starRating'); "context" : "envParam:quiltName", { } }, "actions" : [ "truncateBodyRetainsHtml" : "false", "componentId" : "kudos.widget.button", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/73806","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hBT4FNNDREnBgJqAHK-WLN09PQgfcCYyu9gACOlX8vM. "disableLabelLinks" : "false", } "dialogKey" : "dialogKey" { "disableLinks" : "false", } "event" : "MessagesWidgetAnswerForm", { { "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); { ] } "triggerEvent" : "click", LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "context" : "", }, "includeRepliesModerationState" : "false", "eventActions" : [ { } $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ Kundennummer und Aktivierungscodebereit legen, Ruf die Benutzeroberfläche der FRITZ!Box mit „http://fritz.box“ auf. "action" : "rerender" // Oops, not the right sequence, lets restart from the top. } "parameters" : { { "quiltName" : "ForumMessage", } "selector" : "#messageview_7", "truncateBodyRetainsHtml" : "false", "context" : "", "eventActions" : [ } }, "disableLinks" : "false", { }, ;(function($) { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, count = 0; "action" : "rerender" }, "event" : "expandMessage", ] }, { } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } "action" : "rerender" "parameters" : { ] { "event" : "MessagesWidgetEditAction", "event" : "deleteMessage", } ] { "context" : "", }, "event" : "kudoEntity", } }, "event" : "MessagesWidgetAnswerForm", })(LITHIUM.jQuery); "event" : "expandMessage", { }, }, ;(function($) { "event" : "removeMessageUserEmailSubscription", ] "action" : "rerender" "revokeMode" : "true", ;(function($) { { "useTruncatedSubject" : "true", "actions" : [ "context" : "", "context" : "", "event" : "MessagesWidgetEditAction", "action" : "rerender" { }); Bist du sicher, dass du fortfahren möchtest? "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "useCountToKudo" : "false", setWarning(pagerId); }, { { "event" : "approveMessage", "initiatorDataMatcher" : "data-lia-kudos-id" { { ] "event" : "ProductMessageEdit", "useSubjectIcons" : "true", { } "action" : "rerender" "action" : "rerender" "actions" : [ { { "componentId" : "forums.widget.message-view", LITHIUM.Dialog.options['-1949137021'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "context" : "", }, } LITHIUM.Dialog({ { "event" : "AcceptSolutionAction", { { ] { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/73806","ajaxErrorEventName":"LITHIUM:ajaxError","token":"U9O46efW961D6mf40PoyogsCAiubgBsec4l7-1EsmTo. "event" : "ProductMessageEdit", } } "defaultAriaLabel" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1663716,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Wir schalten jetzt Deine FRITZ!Box für den Einsatz an Deinem Kabelanschluss frei. "event" : "approveMessage", { "actions" : [ } "action" : "rerender" "actions" : [ { "useCountToKudo" : "false", "action" : "rerender" "actions" : [ { "showCountOnly" : "false", if ( neededkeys[count] == key ) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); }, { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1663374 .lia-rating-control-passive', '#form_4'); "event" : "MessagesWidgetEditAnswerForm", Starte die FRITZ!Box neu, um die Einrichtung des Internetzugangs abzuschließen. "buttonDialogCloseAlt" : "Schließen", "event" : "approveMessage", ] { "action" : "rerender" "initiatorBinding" : true, } "truncateBody" : "true", { "actions" : [ "initiatorBinding" : true, }); { } ], "event" : "RevokeSolutionAction", "event" : "ProductMessageEdit", LITHIUM.AjaxSupport.ComponentEvents.set({ if ( !watching ) { "initiatorBinding" : true, "event" : "MessagesWidgetAnswerForm", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1663409 .lia-rating-control-passive', '#form_5'); "context" : "", }, "context" : "envParam:quiltName,message", }, lithadmin: [] { $(document).ready(function(){ { "action" : "addClassName" "context" : "", element.removeClass('active'); { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1663793 .lia-rating-control-passive', '#form_8'); "actions" : [ "context" : "", }); "componentId" : "kudos.widget.button", } ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "actions" : [ "includeRepliesModerationState" : "false", }, }); { "selector" : "#kudosButtonV2_3", { "context" : "", Das ist mit DS-L nicht der Fall, wenn wie bei deiner Arbeit kein IPV6 unterstützt wird, du aber mit einer IPV6 DS-L bei deiner Arbeit bezw. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" ] ] LITHIUM.AjaxSupport.ComponentEvents.set({ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } } } ] "selector" : "#messageview_5", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "eventActions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "pulsate" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", }, "action" : "rerender" { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivKIP/thread-id/73806","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7o2jI7UlIAinqcE04X9mryn-LDQq4xeFYOEXptfq3ps. }); { ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { ] { LITHIUM.Dialog.options['-1805077719'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "action" : "rerender" { "context" : "", } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "addThreadUserEmailSubscription", LITHIUM.AjaxSupport.ComponentEvents.set({ { { "actions" : [ { }, ] { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1663929 .lia-rating-control-passive', '#form_9'); }); "event" : "editProductMessage", "action" : "rerender" $('.community-menu').removeClass('active') "action" : "pulsate" "action" : "rerender" }, { "actions" : [ }, ] { ] "event" : "removeMessageUserEmailSubscription", }, "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivKIP/thread-id/73806","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7o2jI7UlIAinqcE04X9mryn-LDQq4xeFYOEXptfq3ps. ] { "actions" : [ }); Prüf bitte selbst, ob Dein Router vollständig den Schnittstellenbeschreibungen entspricht. { "action" : "rerender" "context" : "", { } { { ] "action" : "rerender" LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/73806","ajaxErrorEventName":"LITHIUM:ajaxError","token":"9HLsdtw9F2Wjbg6vPQ8NgB8EKBSm7qVbS2t6eB4OALc. "}); }, "actions" : [ "displayStyle" : "horizontal", "actions" : [ // Reset the conditions so that someone can do it all again. "event" : "MessagesWidgetEditAction", ] return; { "action" : "rerender" }, ] }); }, { "displayStyle" : "horizontal", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "addMessageUserEmailSubscription", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1663929 .lia-rating-control-passive', '#form_9'); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" }, }, "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "triggerSelector" : ".lia-panel-dialog-trigger-event-click", { "action" : "pulsate" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_9","componentSelector":"#lineardisplaymessageviewwrapper_9","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1663929,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "eventActions" : [ }, "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ "dialogContentCssClass" : "lia-panel-dialog-content", ] "disallowZeroCount" : "false", "context" : "", "}); { { "actions" : [ ;(function($) { "context" : "envParam:feedbackData", Trag dann die Anmeldedaten ein, die Dir nach der Freischaltung im Aktivierungsportal angezeigt wurden. "event" : "AcceptSolutionAction", } { "event" : "addMessageUserEmailSubscription", }, "componentId" : "kudos.widget.button", "displaySubject" : "true", }, }, LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); clearWarning(pagerId); "disableKudosForAnonUser" : "false", "actions" : [ "initiatorBinding" : true, } function clearWarning(pagerId) { } "action" : "rerender" "kudosable" : "true", } "event" : "kudoEntity", Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" } "forceSearchRequestParameterForBlurbBuilder" : "false", expireDate.setDate(expireDate.getDate() + 365*10); "eventActions" : [ "actions" : [ { ] } ] "eventActions" : [ } { { "actions" : [ "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); "selector" : "#messageview_6", "actions" : [ "useCountToKudo" : "false", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'HPe1ltjpAaCTsihfKTQYQxm_Jn3cf2Zpy5LDeM8bzS4. "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", } "event" : "approveMessage", }, }, .attr('aria-expanded','false'); Hallo zusammen, ich wurde am 1. "action" : "rerender" "kudosLinksDisabled" : "false", return; ] }, }, ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1663290 .lia-rating-control-passive', '#form_2'); { "actions" : [ }, "action" : "rerender" "disableLabelLinks" : "false", { "action" : "rerender" "event" : "QuickReply", "initiatorDataMatcher" : "data-lia-message-uid" "useTruncatedSubject" : "true", "event" : "AcceptSolutionAction", } } { { "event" : "unapproveMessage", "context" : "envParam:quiltName,expandedQuiltName", document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); { ] "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ } }, "disableKudosForAnonUser" : "false", "action" : "rerender" }, "action" : "rerender" "action" : "rerender" "disableKudosForAnonUser" : "false", "action" : "rerender" { { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ function processPageInputBlur(pagerId, val) ] ] "actions" : [ logmein: [76, 79, 71, 77, 69, 73, 78], LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1663220 .lia-rating-control-passive', '#form_1'); "event" : "unapproveMessage", { }, }, }, "useCountToKudo" : "false", LITHIUM.Loader.runJsAttached(); "quiltName" : "ForumMessage", "actions" : [ ', 'ajax'); "initiatorBinding" : true, } "actions" : [ } setWarning(pagerId); } ] "componentId" : "kudos.widget.button", LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); resetMenu(); { } else { "useCountToKudo" : "false", ] { $(document).ready(function(){ { "event" : "MessagesWidgetEditAction", "action" : "rerender" "event" : "ProductAnswerComment", "event" : "MessagesWidgetCommentForm", }); "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", { "disallowZeroCount" : "false", ] }, LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ "actions" : [ "event" : "addMessageUserEmailSubscription", "context" : "", $('section.header-announcement').slideUp(); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "initiatorBinding" : true, "actions" : [ { "action" : "rerender" "actions" : [ "context" : "", { "action" : "rerender" } "context" : "envParam:quiltName", { } } "linkDisabled" : "false" "event" : "addThreadUserEmailSubscription", "event" : "editProductMessage", { }); { Du könntest dir diesen Thread einmal durchlesen. "kudosLinksDisabled" : "false", Bitte beachten: Deine Anmeldedaten findest Du nach der Freischaltung der FRITZ!Box in MeinVodafone unter Einstellungen > SIP-Daten. "event" : "MessagesWidgetEditCommentForm", "actions" : [ }); { ] LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); ] }, "event" : "ProductAnswer", "event" : "expandMessage", "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAction", "actions" : [ { }); "context" : "envParam:entity", }, "truncateBody" : "true", { LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" "action" : "rerender" setWarning(pagerId); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_53","feedbackSelector":".InfoMessage"});

Be Fit & Wellness Holding Gmbh, Feldwebel Oder Offizier, Dell Uefi Add Boot Option File System Not Found, Miniatur Bullterrier Berlin Haltung, Wohnprojekte Villach Land, Anne-sophie Mutter Lebensgefährte, Uni Marburg Slavistik,