3. Februar 2021

vodafone dynamische ip

var notifCount = 0; // enable redirect to login page when "logmein" is typed into the void =) }, "event" : "addThreadUserEmailSubscription", // Set start to true only if the first key in the sequence is pressed { { "context" : "", }, "forceSearchRequestParameterForBlurbBuilder" : "false", } { "event" : "kudoEntity", "actions" : [ { "actions" : [ { { "actions" : [ { "event" : "MessagesWidgetAnswerForm", "actions" : [ ], { "action" : "rerender" } else { "action" : "addClassName" "context" : "", "context" : "", return false; { "action" : "rerender" ] LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; { ', 'ajax'); } "actions" : [ })(LITHIUM.jQuery); }); "initiatorBinding" : true, "initiatorBinding" : true, LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); } }, "parameters" : { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "kudosLinksDisabled" : "false", "event" : "unapproveMessage", "event" : "MessagesWidgetAnswerForm", } "selector" : "#kudosButtonV2_6", ] var count = 0; { ] "initiatorDataMatcher" : "data-lia-kudos-id" { "disableKudosForAnonUser" : "false", { }, { setWarning(pagerId); } { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "selector" : "#messageview_5", ] { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "useSubjectIcons" : "true", "selector" : "#messageview_2", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ ] "eventActions" : [ { Bist du sicher, dass du fortfahren möchtest? }, "event" : "MessagesWidgetCommentForm", "truncateBody" : "true", "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "actions" : [ "actions" : [ "showCountOnly" : "false", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "parameters" : { { return false; } } { Nach einem Bericht von Spiegel Online haben die Telekom und Vodafone bereits angekündigt, ihren Kunden auf IPv6-Basis ebenfalls weiterhin dynamische IP-Adressen zuteilen zu wollen. { } "action" : "rerender" { { "action" : "rerender" { } "truncateBody" : "true", ] "disableLabelLinks" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, ] if (val.trim() == "") "useTruncatedSubject" : "true", "action" : "rerender" "actions" : [ "context" : "", "actions" : [ "context" : "lia-deleted-state", } { "action" : "addClassName" "revokeMode" : "true", { "selector" : "#kudosButtonV2_8", { watching = false; { { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "eventActions" : [ } "actions" : [ "actions" : [ { "actions" : [ "useCountToKudo" : "false", "closeEvent" : "LITHIUM:lightboxCloseEvent", "buttonDialogCloseAlt" : "Schließen", "event" : "ProductAnswer", "action" : "rerender" "action" : "rerender" "action" : "rerender" "actions" : [ }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "event" : "MessagesWidgetEditAction", "context" : "", "event" : "MessagesWidgetEditAnswerForm", "event" : "editProductMessage", } "disableKudosForAnonUser" : "false", // We made it! { "action" : "rerender" { return false; { "action" : "rerender" }, "event" : "removeThreadUserEmailSubscription", ] { "context" : "", "action" : "rerender" "action" : "rerender" })(LITHIUM.jQuery); } else { "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/3241","ajaxErrorEventName":"LITHIUM:ajaxError","token":"lF6_kTsD9uIxqQLodRLmyIDvcYKGtgRlFXnjL38E-zk. LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "context" : "", "action" : "rerender" }, } "event" : "removeMessageUserEmailSubscription", "event" : "unapproveMessage", "displayStyle" : "horizontal", "actions" : [ }, "context" : "", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); { ] }, } { } "action" : "rerender" }, { { { } LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "action" : "rerender" "selector" : "#kudosButtonV2_5", { "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", { "actions" : [ { }, return false; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/3241","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hHZh7KR1CpPpT62v8DxgZTkGwspap4yi6RsB54aJUq4. ] "action" : "rerender" } "disableLinks" : "false", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); "action" : "rerender" "event" : "ProductAnswerComment", "actions" : [ "context" : "envParam:quiltName", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; Ob statische oder dynamische IP-Adresse, hängt doch wohl von der Defintion ab. ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] { "forceSearchRequestParameterForBlurbBuilder" : "false", ;(function($) { "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, ] LITHIUM.Dialog.options['-1239281098'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; })(LITHIUM.jQuery); "actions" : [ LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); { { { "actions" : [ ', 'ajax'); ] "actions" : [ "action" : "rerender" $(this).next().toggle(); LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "event" : "removeThreadUserEmailSubscription", { { }); "event" : "MessagesWidgetEditAction", if (1 != val) }); "event" : "MessagesWidgetEditAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); }); watching = false; } .attr('aria-expanded','false'); } { "showCountOnly" : "false", { { $(this).next().toggle(); window.location.replace('/t5/user/userloginpage'); { $('#node-menu li.active').children('ul').show(); window.location.replace('/t5/user/userloginpage'); "event" : "ProductAnswerComment", "event" : "MessagesWidgetEditAction", }, "entity" : "52312", { } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "componentId" : "kudos.widget.button", } // We made it! "event" : "addMessageUserEmailSubscription", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'FZexrduCSWNHmf7e7QcDBfZx5xHLQ1ivgSVTU_8_ZSU. { "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }); { }, "buttonDialogCloseAlt" : "Schließen", count = 0; Wenn die IP bei VF als dynamisch gilt, sehe ich den Wechsel der IP , obwohl so nicht als real existent gegeben, eher als un-dynamisch an. } } "actions" : [ }, { //$('#vodafone-community-header').css('display','block'); "context" : "", { "event" : "MessagesWidgetEditAction", "event" : "MessagesWidgetEditAction", "actions" : [ } LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "event" : "ProductAnswerComment", ] "disableLabelLinks" : "false", } "componentId" : "kudos.widget.button", "event" : "MessagesWidgetMessageEdit", "actions" : [ ] "disableKudosForAnonUser" : "false", routable on the internet) also want STATIC IPs. "actions" : [ "revokeMode" : "true", "context" : "envParam:quiltName", var count = 0; ], "truncateBodyRetainsHtml" : "false", ] { { "displayStyle" : "horizontal", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:entity", "defaultAriaLabel" : "", { if (isNaN(val) ) { ] LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; } { { "action" : "pulsate" LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true);

Scandic Hamburg Massage, Handwerkskammer Düsseldorf Logo, Corona-verordnung Saarland Aktuell, Hochschule Anhalt Immatrikulation, Jobcenter Zahlt Nicht Was Tun, Außerordentliche Kündigung Definition, Wilhelm Busch Lebenslauf,