3. Februar 2021

vodafone feste ipv4

] { "action" : "rerender" }, "displayStyle" : "horizontal", }); "eventActions" : [ }, "linkDisabled" : "false" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1768409,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); { "context" : "lia-deleted-state", Das gilt aber nur für den HiTron-Gammel, die FritzBox kann das AFAIK nicht. }, "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "pulsate" ] }); "disableKudosForAnonUser" : "false", { LITHIUM.AjaxSupport.ComponentEvents.set({ } { { "truncateBodyRetainsHtml" : "false", } }, } "event" : "expandMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" { "event" : "MessagesWidgetMessageEdit", "action" : "rerender" "action" : "rerender" "action" : "rerender" ] { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); } { "action" : "rerender" "actions" : [ ] "actions" : [ { ] "actions" : [ Bist du sicher, dass du fortfahren möchtest? "componentId" : "kudos.widget.button", // Reset the conditions so that someone can do it all again. ] "actions" : [ { { o.innerHTML = "Page number can\'t exceed 2. } { if ( key == neededkeys[0] ) { }, }); }, Was ist die Option Feste IP? "action" : "rerender" "disableKudosForAnonUser" : "false", ] "event" : "MessagesWidgetAnswerForm", "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,message", document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "context" : "", "context" : "envParam:quiltName,message", ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "disableLinks" : "false", ] "useCountToKudo" : "false", "action" : "rerender" ], My Vodafone "context" : "envParam:selectedMessage", LITHIUM.Dialog.options['-1900081526'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "lia-deleted-state", "selector" : "#messageview_3", "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "kudosLinksDisabled" : "false", "dialogKey" : "dialogKey" } LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } { if (val.trim() == "") "initiatorBinding" : true, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); { "action" : "rerender" ', 'ajax'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/281739","ajaxErrorEventName":"LITHIUM:ajaxError","token":"JeyzPZ2NWESN0fIhL5jcCLuN3K0beJT0ao8ZlEPd390. "action" : "rerender" "actions" : [ "displaySubject" : "true", "context" : "", { "event" : "ProductAnswerComment", }, "actions" : [ ] "useSimpleView" : "false", "kudosLinksDisabled" : "false", } "message" : "1768409", var expireDate = new Date(); { "event" : "addMessageUserEmailSubscription", "action" : "rerender" "event" : "expandMessage", { }, "context" : "envParam:quiltName,product,contextId,contextUrl", // Set start to true only if the first key in the sequence is pressed "event" : "deleteMessage", "}); "context" : "envParam:quiltName,message", "event" : "approveMessage", { "action" : "rerender" Execute whatever should happen when entering the right sequence ] "action" : "pulsate" "displaySubject" : "true", ] ] LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); An den "großen" Router im Vodafone Rechenzentrum kommst Du nicht ran. "action" : "pulsate" } ] { ] "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, "action" : "rerender" "initiatorBinding" : true, // If watching, pay attention to key presses, looking for right sequence. ] "event" : "addMessageUserEmailSubscription", "actions" : [ "actions" : [ "context" : "", "context" : "", } "kudosLinksDisabled" : "false", "disableLabelLinks" : "false", "event" : "RevokeSolutionAction", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ } "context" : "", { ], "action" : "rerender" } "truncateBodyRetainsHtml" : "false", "action" : "rerender" "action" : "rerender" { } { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { von Menne » 18.02.2019, 06:25, Beitrag "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "selector" : "#messageview_2", } "action" : "pulsate" "actions" : [ $(document).ready(function() { }, } "actions" : [ LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "event" : "expandMessage", ] "event" : "ProductAnswer", ] $(document).ready(function(){ LITHIUM.AjaxSupport.ComponentEvents.set({ { { ], }, "actions" : [ } if ( Number(val) < 1 ) }, ] "event" : "addMessageUserEmailSubscription", "context" : "", "action" : "rerender" "event" : "expandMessage", }, } ] "context" : "envParam:quiltName", "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", { { "initiatorBinding" : true, "componentId" : "kudos.widget.button", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "context" : "", { "useSimpleView" : "false", "action" : "pulsate" "componentId" : "forums.widget.message-view", { { { "actions" : [ { "event" : "QuickReply", { "event" : "addThreadUserEmailSubscription", ] { { "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); count = 0; { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", }, "truncateBodyRetainsHtml" : "false", ] { "action" : "rerender" "actions" : [ }, "actions" : [ { { disableInput(pagerId); ] { LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); // --> }, "kudosLinksDisabled" : "false", "useSimpleView" : "false", "action" : "pulsate" ] "entity" : "1768409", }, { "disableKudosForAnonUser" : "false", "displaySubject" : "true", { }, { { { var clickedDomElement = $(this); "context" : "envParam:quiltName", }, ] if ( key == neededkeys[0] ) { ], "context" : "envParam:selectedMessage", "context" : "", }); "event" : "MessagesWidgetEditAction", }, "useCountToKudo" : "false", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" ', 'ajax'); ] "action" : "rerender" ] "action" : "addClassName" "action" : "rerender" }, "context" : "", "disableLabelLinks" : "false", } "actions" : [ "context" : "envParam:feedbackData", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1768401,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten.

Champignons Aus Der Dose Gesund, Grundstück Für Mobilheim Ostsee Kaufen, Hähnchen Gemüse Backofen Kartoffeln, Gesunde Rezepte Zur Fettverbrennung, Sky Racing Team Vr46 Merchandise, Aufstellung Wm-finale 2014, Tanzlokale In Westerland, Pizzeria Bergisch Gladbach,